Protein Info for CCNA_02457 in Caulobacter crescentus NA1000

Annotation: nitropropane dioxygenase/trans-enoyl-CoA reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF03060: NMO" amino acids 72 to 307 (236 residues), 75.8 bits, see alignment E=4.4e-25 PF01070: FMN_dh" amino acids 128 to 224 (97 residues), 31.7 bits, see alignment E=8.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02457)

Predicted SEED Role

"Dioxygenases related to 2-nitropropane dioxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC55 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CCNA_02457 nitropropane dioxygenase/trans-enoyl-CoA reductase family protein (Caulobacter crescentus NA1000)
MALPPILRDRLRLPVIASPLFIISNPDLVIAQCKAGIVGSFPSLNARPLSQLDEWLARIT
EELAAWDKANPDMPSAPFAVNQIVHKTNNRLEDDIAMCVKYKVPLVITSLGAREDVNQAI
HSYGGITLHDVITDRFARKAIEKGADGLIPVAAGAGGHAGTLSPFALIQEIRQWFDGPVA
LSGSIASGRSILAAQAMGADLAYVGSAFIATKEANAVEGYKQMIVDSKADDILYSNLFTG
VHGNYLRPSVIKAGLDPENLPESDPSKMNFGSGGNQDAKAWRDIWGCGQGIGAIDNVLTA
GELVAKFAAEYEQAKAELAAKTALTAGKHLAFAAE