Protein Info for CCNA_02450 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details PF03994: DUF350" amino acids 24 to 76 (53 residues), 45.3 bits, see alignment E=3.8e-16 amino acids 88 to 141 (54 residues), 46 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: K08989, putative membrane protein (inferred from 100% identity to ccs:CCNA_02450)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAH2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>CCNA_02450 hypothetical protein (Caulobacter crescentus NA1000)
MRRASQMFDFIGFKEGAMAFLLAFALAGLFTIAFKYVYQWVTPYNEKALIREGNTAAAIA
LAGALIGYVLPLASALSHTVSLPEFAAWATLAGVIQIAAFTGVRLVALPDVKARIENGEV
SVGVYLAGISIAVGLLNAACMTT