Protein Info for CCNA_02445 in Caulobacter crescentus NA1000

Annotation: copper homeostasis protein cutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF03932: CutC" amino acids 7 to 205 (199 residues), 307.7 bits, see alignment E=1.6e-96

Best Hits

Swiss-Prot: 100% identical to CUTC_CAUVC: Copper homeostasis protein CutC (cutC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06201, copper homeostasis protein (inferred from 100% identity to ccs:CCNA_02445)

Predicted SEED Role

"Cytoplasmic copper homeostasis protein CutC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZC1 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_02445 copper homeostasis protein cutC (Caulobacter crescentus NA1000)
MSAHRVLLEVCVDTPAGLAAAIAGGADRVELCSALALQGLTPAPGLMAQAASAPIPVYPM
IRPRHGDFCYDARDLDAMRRDIDAVRGYGLPGVTIGASQANGALDLKVLRKLVEQAEGLG
TTLHRAFDVVPDMSEALEIAVELGFERVLTSGGALSALDATDRLAALVEQAGERISIMAG
AGVRPGNIAELVRRTGVREAHGSFGGPVPGADPRSQLGAMGFVPPELRDTSQAAVAEAVK
ALRAL