Protein Info for CCNA_02439 in Caulobacter crescentus NA1000

Annotation: transporter, major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 384 (360 residues), 141.4 bits, see alignment E=1.8e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2354)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAG1 at UniProt or InterPro

Protein Sequence (430 amino acids)

>CCNA_02439 transporter, major facilitator superfamily (Caulobacter crescentus NA1000)
MSDPSSALERATVGRVTRRLMPLFCLMYLIAYIDRQNVSYAKLDMVSALGLSEAAYGLGA
SLFFIGYFLFEAPANLILARVGARVWFARIMFSWGLVTLALGFTQNAAMFYVLRFLLGVA
EAGFFPGVLYVLTLWYPQAHRARMVGLFMIASAFANAVGAAIGGLLLGMDGFLGLAGWQW
VFLVTGAPAVLLAPYVLWRLPSGPSDARWLPDVEKSWLASTLAAERGGEVDDHRGAWKAI
FDPRVLMLAGLYIGMPLSAYGLSYWLPTIVKSFGVSNTVNGFINVIPWLLVAVALWFVPR
HAARHGASAWHIAGPVLLAAVALSLSVILPGAALKFTMLCIAAPAIFAAQPVFWSLPPSF
LSGPRAAAGIATINAVGNLGGFIAQNLVPVVRDATGSELAPMLALAAVLLVTSLLIFIVM
GRLRKMSPAT