Protein Info for CCNA_02438 in Caulobacter crescentus NA1000

Annotation: quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 156 to 176 (21 residues), see Phobius details PF08240: ADH_N" amino acids 27 to 118 (92 residues), 39.1 bits, see alignment E=1.2e-13 PF00107: ADH_zinc_N" amino acids 164 to 243 (80 residues), 50.1 bits, see alignment E=4.2e-17 PF13602: ADH_zinc_N_2" amino acids 195 to 320 (126 residues), 75.8 bits, see alignment E=9.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02438)

Predicted SEED Role

"alcohol dehydrogenase, zinc-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9S2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>CCNA_02438 quinone oxidoreductase (Caulobacter crescentus NA1000)
MKAVTCRRYGSPDMLAIETIERPKPRRDEVLVRVTNSTVTSGDTRLRGFRGPLLFWLPLR
LAFGVFRPRQPITGMEFAGDVVALGSAVKGLRPGDRVFGMKLGGANAEYVTVKATAALAR
CPDRLSDDQCAATPFGALSALTFVRDTAELRPGERILIYGASGAVGVFAIQLAKILGAHV
TAVSSARNLQMVLDLGADRALDYAAPDFRLEAEAYDVILDTVGATRFSQCRHALGPTGRH
VFAEVDGGRLLQSLWTSFCSGPRVLCGFSAGDSPEDMTLIARHLDRGVLRPVIDRRYTMA
QIIEAHRYVELGRKRGAVVIRVAD