Protein Info for CCNA_02432 in Caulobacter crescentus NA1000

Annotation: nucleobase-cation-symport-1 (NCS1) transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 98 (16 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 395 (26 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details TIGR00800: NCS1 nucleoside transporter family" amino acids 10 to 440 (431 residues), 385.7 bits, see alignment E=1.3e-119 PF02133: Transp_cyt_pur" amino acids 18 to 465 (448 residues), 388.4 bits, see alignment E=2.2e-120

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to ccr:CC_2347)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9R7 at UniProt or InterPro

Protein Sequence (488 amino acids)

>CCNA_02432 nucleobase-cation-symport-1 (NCS1) transporter (Caulobacter crescentus NA1000)
MRAPDSDLWNEDLAPTVEAQRNWRWWHFAALWLGMVICVPAYMLASGLIEQGMSASQAVL
TVLLGNVIVLVPMLLIGHSGARWGVPYAVLARASFGWKGARVPAVARAIVACGWYGIQTW
IGGGALLTLLGVIVGRKLEGAPLPLLGIGVGQLLAFFAFWGVQLLFVTKGLTAIRRLETW
TAPIKILICALMVWWAVDKAGGLGPILHQPSAFAAGGAKAGQFWSVFAPAVTAMVGFWAT
LALNIPDFTRFARRQSDQIIGQAVGLPVPMGLLALVSVVTTSATTIIFGKAIWDPVQLAG
DIGGVAVVVGLLIISLDTVCCNIAANLVGPAYDFSALWPSKISYRMGGWITAVIGVLIMP
WKLLETTQGYIFTWLVGYGALLGPIAGILIVDYWIVRKARLDVDDLYVRDGAYAYRGGWN
PAAVAALLLGVALNIPGFLAAAAPHLFGGVGSIWTGLYTYAWFVGLAIAAIVYGALMYRF
RTRDPAIP