Protein Info for CCNA_02429 in Caulobacter crescentus NA1000

Annotation: arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02429)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

arsenate detoxification III (2/2 steps found)
arsenic detoxification (bacteria) (2/4 steps found)
arsenate detoxification I (3/6 steps found)
arsenic detoxification (plants) (3/6 steps found)
arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC27 at UniProt or InterPro

Protein Sequence (152 amino acids)

>CCNA_02429 arsenate reductase (Caulobacter crescentus NA1000)
MPQSLPDAVLFTCNYNRVRSPMAEGLFKRFYGTRAYVDSCGLKSDPAGEGIDPFVVVVMD
ELGLDVSDHRPKTFAQLEDDSFDVVVSLTPEAQHRAVELSRDRAVEIEYWPTHDPTLTDG
SREARLEAYREVRDALAAAIKRRFGAPSTFGG