Protein Info for CCNA_02424 in Caulobacter crescentus NA1000

Annotation: TetR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 148 to 163 (16 residues), see Phobius details PF00440: TetR_N" amino acids 13 to 58 (46 residues), 40.4 bits, see alignment 2e-14 PF13305: TetR_C_33" amino acids 86 to 190 (105 residues), 56.1 bits, see alignment E=5.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02424)

Predicted SEED Role

"transcriptional regulator, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C918 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CCNA_02424 TetR-family transcriptional regulator (Caulobacter crescentus NA1000)
MPRPERDLREACLKEALAIIEHEGVERLSLRDVARRLGVSHQAPYRHFPSRDHILAEVVA
RAFEEFARHLDAHPKSSDPDRDMGLMGEAYLAYAAKHPLQYQLMFATPLPSTDTHPEMMA
KARHAFDMLLSALRRKAAEQGRSLAEEAIVLDALFIWSGLHGLAMLRNSSAFDTLGLRGA
AIENSTAHLLSRFGDALGH