Protein Info for CCNA_02422 in Caulobacter crescentus NA1000

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF08659: KR" amino acids 14 to 194 (181 residues), 64.3 bits, see alignment E=2.9e-21 PF00106: adh_short" amino acids 15 to 201 (187 residues), 143 bits, see alignment E=1.7e-45 PF01370: Epimerase" amino acids 16 to 136 (121 residues), 31.2 bits, see alignment E=3.2e-11 PF13561: adh_short_C2" amino acids 20 to 202 (183 residues), 91.7 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 100% identity to ccr:CC_2337)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAL7 at UniProt or InterPro

Protein Sequence (275 amino acids)

>CCNA_02422 short chain dehydrogenase (Caulobacter crescentus NA1000)
MSKSVQKRSPRYGATALVTGASDGIGEAFARELARRGYNLILVARREDRLRALADAVQSK
YGVQARVIAADLGKAEDVERVIAATAAEDVGLLVAAAGFGTSGAFVEQPIEPELDMIDVN
CRAVVALTHAFARRFIRRGAGGIVLFGSLVGFQGVPRAANYAATKAFIQSFVEGLRPELK
QFGVDVISVAPGPVASGFAARANMVMGAAAKPGRIPREALAALGRKTTVRPGFLSKALEA
LFFGLPRGARTLIMTQVMKSMARGTAEGMPSPPGR