Protein Info for CCNA_02418 in Caulobacter crescentus NA1000

Annotation: uracil DNA glycosylase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 396 to 415 (20 residues), see Phobius details TIGR03915: probable DNA metabolism protein" amino acids 9 to 232 (224 residues), 207 bits, see alignment E=5.6e-65 PF13566: DUF4130" amino acids 74 to 231 (158 residues), 146.8 bits, see alignment E=5.1e-47 TIGR03914: uracil-DNA glycosylase family domain" amino acids 234 to 467 (234 residues), 306.4 bits, see alignment E=2e-95 PF03167: UDG" amino acids 306 to 466 (161 residues), 102.1 bits, see alignment E=2.9e-33

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 100% identity to ccr:CC_2333)

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC18 at UniProt or InterPro

Protein Sequence (479 amino acids)

>CCNA_02418 uracil DNA glycosylase superfamily protein (Caulobacter crescentus NA1000)
MQVVRLASEVDFAGWRRAARVLRAEGARPESLVWTVERELFDNDEPVTDAATTFVVPAAF
MEMAQQVVLNRSLDRFALLYRILWRLEREPRLIENPADQDMARARDMAKAVSRAAHKMKA
FVRFRRVEDAAKETYAAWFEPAHRVTEATAPFFARRFSNMNWTILTPDVCVAWNGERLWV
SEGADPADAPSEDAQEALWRTYYASIFNPARLNPRQMRQEMPKRYWRNLPEAALIPGLIE
AAQDRAAAMVTTPPRPPSERVLKAAQRHARDAPYNAGAPTTLDAVRAGVSVCRRCDLWRE
ATQGVPGDGAPSAPLMFVGEQPGDQEDLAGSPLVGPAGQIFDRALAEVSVRREQTYVTNA
VKHFKHELNGKRRLHKTPTQGEVSACRWWLDAERRLVRPTVIVMLGATAAFGVMGRPTPV
RETRGRPLPLPDGVQGLVTFHPSYLLRLPDAAARENAYRSFVDDLRLAGRLAGLAATSP