Protein Info for CCNA_02400 in Caulobacter crescentus NA1000

Annotation: transporter, major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 353 (27 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details PF13347: MFS_2" amino acids 53 to 131 (79 residues), 31.4 bits, see alignment E=7.6e-12 PF07690: MFS_1" amino acids 59 to 253 (195 residues), 73.7 bits, see alignment E=1.4e-24 amino acids 273 to 412 (140 residues), 53.5 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02400)

Predicted SEED Role

"FIG00481860: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9P4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>CCNA_02400 transporter, major facilitator superfamily (Caulobacter crescentus NA1000)
MRPDDVARPKEPVRANFIAAYTLAQIAAFVSFQPLLQVLLPLKAEAIDPAGKAIVLAQVA
FYGAIAASIANLLAGAISDRTTSRFGRRRPWMVVGALAASLAYLAIMHAKTPAALIGGVI
LFQLAFNLCFSALMAVMPDRVPDTQKGMVAAFLSLGNPIGTAIGAVVVGGLLVTESYRYA
AISAALLLGLAPFVIRLRDPPLPKSAVPPFNLRAFVAGLWVSPRKHPDFAFAWLGRFLVL
VAFSLVQSYMLYFLKDEVDYPHLFPGRRAEEGLAILAAVSTVFNVICAMLGGVLSDRLRR
RKLFAFGAALTVALSLIVFSMSPGWPLLVVAFIVYGCGVGCFSAVDIALVTQVLPSQRDA
GKDLGVINLANTLPQALAPALAVWSLGPTHGDFKMFFLVASALALAGGLAILPIRGVR