Protein Info for CCNA_02389 in Caulobacter crescentus NA1000

Annotation: glucosamine-1-phosphate acetyltransferase/UDP-N-acetylglucosamine pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 13 to 446 (434 residues), 466.3 bits, see alignment E=5.2e-144 PF00483: NTP_transferase" amino acids 14 to 166 (153 residues), 29.8 bits, see alignment E=1.1e-10 PF01128: IspD" amino acids 14 to 130 (117 residues), 38.8 bits, see alignment E=2.2e-13 PF12804: NTP_transf_3" amino acids 14 to 152 (139 residues), 74.3 bits, see alignment E=3.2e-24 PF00132: Hexapep" amino acids 310 to 344 (35 residues), 35.9 bits, see alignment 1e-12 amino acids 388 to 422 (35 residues), 29.6 bits, see alignment 9.9e-11 PF14602: Hexapep_2" amino acids 388 to 422 (35 residues), 26.9 bits, see alignment 7.9e-10

Best Hits

Swiss-Prot: 100% identical to GLMU_CAUVN: Bifunctional protein GlmU (glmU) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to ccr:CC_2304)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYT1 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CCNA_02389 glucosamine-1-phosphate acetyltransferase/UDP-N-acetylglucosamine pyrophosphorylase (Caulobacter crescentus NA1000)
MTESVSKPVRPRAAVILAAGQGTRMKSPTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVV
VGAHSPQVGESARKRLGPDATVIQDPPLGTGHAVLAAKDALADFHGDVVVTYADCPLTTA
PVIAPLFDLITHVAHVAVLGFEAQNPTGYGRLILAPGHVLLRIVEEKEADLATKQVKHCN
SGVLAADRAVLFDLLANVRNDNAKGEYYLTDVVGLAHERHLSTRTAFAPEASVQGVNAQA
ELAAAEAVWQQNRRKALMVDGVTMPAPDTVHLAWDTQIAGGAVVEQFVVFGPGVSVASGA
VIKAFSHLEGAVVGEGALIGPYARLRPGAEIGPDAHIGNFVEVKKVKVGAGAKANHLSYL
GDGSVGEKANIGAGTIFCNYDGFEKFETHVGKGAFIGSNSALVAPVRVGDGAMTGSGSVI
TKDVEDGALALSRADQTSKAGWATKFRAIKQAQKDKKKDKKA