Protein Info for CCNA_02388 in Caulobacter crescentus NA1000

Annotation: ribose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 6 to 222 (217 residues), 258.6 bits, E=1.9e-81
• PF06026: Rib_5-P_isom_A
  • amino acids 49 to 221 (173 residues), 191.3 bits, E=5.6e-61

Best Hits

Swiss-Prot: 100% identical to RPIA_CAUVC: Ribose-5-phosphate isomerase A (rpiA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to ccr:CC_2303)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (7/8 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

See B8GYT0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>CCNA_02388 ribose 5-phosphate isomerase (Caulobacter crescentus NA1000)
MSADDQKRISGEAAAELVENGMVVGLGTGSTAAWFVKALAARGLKDIRGVPTSDATAALA
RELGIPLAALDDVKTVDLTVDGADEIGPGLSLIKGGGAALLREKLVWEASTRCVVIADAA
KRVPALGKFPLPIEVVRFGHVHTGYRLADIAAEFDLPPPRLRTAERGMVVTDGGNLIYDM
ASGKIEDPTALAAALKSVTGVVDHGLFLDLADEALVGTDEGVVRLQP