Protein Info for CCNA_02387 in Caulobacter crescentus NA1000

Annotation: glutathione reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR01424: glutathione-disulfide reductase" amino acids 4 to 454 (451 residues), 798.8 bits, see alignment E=5.8e-245 PF07992: Pyr_redox_2" amino acids 6 to 325 (320 residues), 226.8 bits, see alignment E=1e-70 PF13738: Pyr_redox_3" amino acids 133 to 309 (177 residues), 45.4 bits, see alignment E=1.7e-15 PF00070: Pyr_redox" amino acids 176 to 247 (72 residues), 70.5 bits, see alignment E=3.6e-23 PF02852: Pyr_redox_dim" amino acids 345 to 453 (109 residues), 109.4 bits, see alignment E=2.8e-35

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to ccr:CC_2302)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9N8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>CCNA_02387 glutathione reductase (Caulobacter crescentus NA1000)
MADYDFDLFVIGAGSGGVRAARLAALSGAKVAVAEEYRVGGTCVVRGCVPKKFMVYASEV
TSQLKTAKGYGWTIEDARFDWKTFLHEKDVEIARLSGIYVTNLQKAGAHLLHGRAQIVDA
HTVEVLPKDGSDDAGTYTARKILVATGGRPVRPVFPGAELGITSDEAFHLPTLPKSVLVV
GGGYIAVEFAGIYAGLGVQTTLLYRGANILRGFDDDVRMHLADELEKRGIKVVLGCSHKS
IEKLDDGRLLSTLSNDLTFETEAVMFATGREPYVQGLGLEKAGVKLNDKGAIAVDKYSKT
NVDSIWAVGDVTDRINLTPVAIREGAAFAQTEFYGNPTTFDHDLVASAVFSQPPVGAVGM
SEAEARQAFGKVDIYRSIFRPMKVTFYGGQERCLIKLVVKQDDERILGVHVVGPDSPEII
QMAAIAVKMGVTKPQWDSTCAVHPTLAEELVTMREKYVPAEVGGAG