Protein Info for CCNA_02386 in Caulobacter crescentus NA1000

Annotation: O-antigen ligase related enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 216 (18 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 246 to 274 (29 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 384 to 402 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2301)

Predicted SEED Role

"FIG00483400: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8Y2 at UniProt or InterPro

Protein Sequence (407 amino acids)

>CCNA_02386 O-antigen ligase related enzyme (Caulobacter crescentus NA1000)
MIQATVPEPRTRWLGALAVFAMVMTPLVGYLIPLWYAAVLSLVGLLAAPTLVRSRAPLLP
MLALVILVGWALISLNWSPAAPHLADLKRDKDVEKFTALKLVLQLALYGAAVAALAQMSH
RSARLAGRVMLVGVAFLGLITFADGVLKAAIYQVLHNLTEEPIRPDLAMVKVSMATYPAI
LLFWPCVRILDAWNFRGRNIAIALIAVCIVAGAHLTGADAPIAALILGGVAWLGTRVIGK
PFVRGLIPAVSALFIFAPMVVLWGVRSGLFAWLYMIAPASWDHRLNIWAFTGNLIVEHAL
RGWGIDASRTFGPAIPLHTHNAALQLWLELGALGAAMAAAFFAWVLYRIVGWTGESRRDG
AMAAAVTVSYLVIGGLSFGVWQEWWLALGALAAIACGVAQKSSALRA