Protein Info for CCNA_02383 in Caulobacter crescentus NA1000

Annotation: alpha/beta hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF20434: BD-FAE" amino acids 55 to 242 (188 residues), 94.9 bits, see alignment E=1e-30 PF07859: Abhydrolase_3" amino acids 71 to 158 (88 residues), 58.9 bits, see alignment E=1.3e-19 PF00326: Peptidase_S9" amino acids 117 to 287 (171 residues), 45.7 bits, see alignment E=1.2e-15 PF00135: COesterase" amino acids 119 to 160 (42 residues), 34 bits, see alignment 3.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2298)

Predicted SEED Role

"esterase/lipase/thioesterase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAB5 at UniProt or InterPro

Protein Sequence (289 amino acids)

>CCNA_02383 alpha/beta hydrolase family protein (Caulobacter crescentus NA1000)
MVELKVSRRAGLAALAATVTAACSPLSIFATVTPKDAARREAKGARYTDGPRGGVDIYAP
PIAHGPAPVAVFFYGGSWDSGRRGDYGWAARAIAAQGFLTLAPDYRLYPEVRYPDFLDDC
AKAVRWAVDNAAALGGDPERIVLIGHSAGAYNAAMLALDPRYLRGVGVDPGAVRAFAGLS
GPYDFLPLKGAITERTFGGAADLAATQPVSFARADAPAAFLATGDKDTTVYPRNTRKLAA
ALRDKGARVEERHYPGVDHAGAVLALSRPFRRKATLLTDMTAFLKDVTA