Protein Info for CCNA_02362 in Caulobacter crescentus NA1000

Annotation: GAF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13185: GAF_2
  • amino acids 56 to 157 (102 residues), 50.3 bits, E=3e-17
• PF01590: GAF
  • amino acids 59 to 158 (100 residues), 40.5 bits, E=4.1e-14

Best Hits

Swiss-Prot: 48% identical to GAFA_DICDI: GAF domain-containing protein A (gafA) from Dictyostelium discoideum

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 100% identity to ccs:CCNA_02362)

MetaCyc: 39% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"GAF domain-containing proteins"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Sequence Analysis Tools

See A0A0H3CA94 at UniProt or InterPro

Protein Sequence (164 amino acids)

>CCNA_02362 GAF domain-containing protein (Caulobacter crescentus NA1000)
MAEAFNDITLSADKATRYAEVADEIASVLDGEPNLTARMATVASMLANSFDSYFWAGFYV
VDPTKERELVVGPYQGTLGCLRIAFGRGVCGAAAATGQTQLVPDVHAFPGHIACDGRSQS
EIVVPVFDPDGRLIAVFDVDSDKPAAFDEIDQAWLEKILKATFG