Protein Info for CCNA_02353 in Caulobacter crescentus NA1000

Annotation: membrane-bound aldehyde dehydrogenase iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00111: Fer2" amino acids 6 to 52 (47 residues), 36.5 bits, see alignment E=5.8e-13 PF13085: Fer2_3" amino acids 36 to 81 (46 residues), 27.5 bits, see alignment E=4.2e-10 PF01799: Fer2_2" amino acids 73 to 146 (74 residues), 93.5 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 57% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 100% identity to ccs:CCNA_02353)

MetaCyc: 57% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAF9 at UniProt or InterPro

Protein Sequence (154 amino acids)

>CCNA_02353 membrane-bound aldehyde dehydrogenase iron-sulfur protein (Caulobacter crescentus NA1000)
MAFNLTVNGESRIADVDGDTPLLWVLRDTLGLVGTKYGCGAALCGACTVHLDGVPVRACV
TPISGVGEQKVTTIEGVGKTTVGAKVQAAWKAVDTPQCGYCQAGQIMSATALLATTPKPT
DEEIDAAMNGNLCRCATYIRIKKAIKVAAGLEKA