Protein Info for CCNA_02328 in Caulobacter crescentus NA1000

Annotation: cell cycle regulatory protein GcrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF07750: GcrA" amino acids 1 to 160 (160 residues), 214.1 bits, see alignment E=6.7e-68

Best Hits

KEGG orthology group: K13583, GcrA cell cycle regulator (inferred from 100% identity to ccs:CCNA_02328)

Predicted SEED Role

"GcrA cell cycle regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9J4 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CCNA_02328 cell cycle regulatory protein GcrA (Caulobacter crescentus NA1000)
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGLSGRAAPSQPARPAFK
APRPARPAAQAMPSAPRRVTPVEAPTSVPVAAAPAPLPAFRHEEPGSATVLTLGAHMCKW
PIGDPSSEGFTFCGRRSSEGPYCVEHARVAYQPQQTKKKSGGAELARSLRRYI