Protein Info for CCNA_02324 in Caulobacter crescentus NA1000

Annotation: heat shock protein 33 hsp33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF01430: HSP33" amino acids 13 to 297 (285 residues), 245.1 bits, see alignment E=4.8e-77

Best Hits

Swiss-Prot: 100% identical to HSLO_CAUVN: 33 kDa chaperonin (hslO) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 100% identity to ccs:CCNA_02324)

Predicted SEED Role

"Chaperone protein Hsp33"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYL6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CCNA_02324 heat shock protein 33 hsp33 (Caulobacter crescentus NA1000)
MTDIAPDTGVLDDVVSAFQIENLPVRGRVVRLGAAIDEVLTRHDYPEPVANLLGEACALA
ALVGSSLKFEGRLIVQAQGDGPVRYVVVDYDTSGGLRGYCRFDPEEVAAVSEGFVRPGAK
TLLGGGVFIMTLDQGPDMDRYQGVTPIEGETLALCAEQYFAQSEQTPTRVRLAVGQADTG
QGATWRAGGILIQVIAGDQARGETQDAWTHVQALFETTGEDELIDPTVSTPTLLWRLFNE
DGVRLLDEKPLKAFCRCSEDRIGVVMDSFSAEEVAEMVEPDGKIHVTCEYCSRIYKLDPP
GA