Protein Info for CCNA_02293 in Caulobacter crescentus NA1000

Annotation: thiol:disulfide interchange protein tlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF00578: AhpC-TSA" amino acids 70 to 182 (113 residues), 58.8 bits, see alignment E=1.1e-19 PF08534: Redoxin" amino acids 70 to 192 (123 residues), 60.1 bits, see alignment E=4.5e-20 PF13905: Thioredoxin_8" amino acids 91 to 183 (93 residues), 35.4 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2210)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAB2 at UniProt or InterPro

Protein Sequence (210 amino acids)

>CCNA_02293 thiol:disulfide interchange protein tlpA (Caulobacter crescentus NA1000)
MNEVQSGQNGEEAKKRNPMRMALAGVILLGVAAVLYVIASASFKPSGPADLTEFKKGAFE
KLDVPATPRPAPTTVFTSMDGKPTTLADFKGRVVVMNLWATWCAPCKAEMPTLAKLQAAY
ATQPVTVLPISVDRDSDLNLVREEMAANPPLVTYRDPSYKLSFDLQPRAQGYPTTIIYDR
QGRERARLAGPADWSAPEVRGIVEKLLAEK