Protein Info for CCNA_02291 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 32 to 399 (368 residues), 88 bits, see alignment E=3.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02291)

Predicted SEED Role

"FIG00480841: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9G4 at UniProt or InterPro

Protein Sequence (412 amino acids)

>CCNA_02291 hypothetical protein (Caulobacter crescentus NA1000)
MRRGSQPMHAPISATERSTIAQIGGRNAPIGALRAFVTLLVIAHHTVLAYTPNPPPIGDF
SQAPYLWQAFPVRDPQKFELFGLLTLINDLFFMSLMFFISGLFVADGLRAKGNGGLLSGR
AARLGVPFVLAAGLLAPLAYFPAWLQAGGDVSIAGFASAWLDLPSWPSGPAWFLWVLLAF
GAIVTLLNLIAPGVIDALGRLVRGADRKPGLFFLGLVIASAVAYIPMSATFTFMHWTQLG
PFTVQTSRVVHYFVYFLAGVAVGAAGVGQGLTDSEGKLAKRWWAWQAAPILPVVGVIAVI
IMAFSPKPPPRVALDIGGGVMFALACATLSFAALATFLRFVKKTGPVAASLQANAYGMYL
THYVFTTWLAWLLLPQAWGGLAKGAAVFVGATLLSWILTMALRRLPLLGRIL