Protein Info for CCNA_02289 in Caulobacter crescentus NA1000

Annotation: MarR/EmrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF12840: HTH_20" amino acids 17 to 59 (43 residues), 29.9 bits, see alignment E=6.3e-11 PF13601: HTH_34" amino acids 18 to 97 (80 residues), 107.8 bits, see alignment E=3.6e-35 PF01022: HTH_5" amino acids 19 to 62 (44 residues), 37.2 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 39% identical to Y432_METJA: Uncharacterized protein MJ0432 (MJ0432) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2206)

Predicted SEED Role

"regulatory protein, ArsR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBP9 at UniProt or InterPro

Protein Sequence (103 amino acids)

>CCNA_02289 MarR/EmrR family transcriptional regulator (Caulobacter crescentus NA1000)
MAPRFDISGLDDVIHGRVRLGIVAYLASAEVADFTELKDVLEVTQGNLSIHLRKLEEAGY
VSIDKSFVGRKPLTRVRLTDTGRAAFSSYLRAMGQLVEQAGGG