Protein Info for CCNA_02250 in Caulobacter crescentus NA1000

Annotation: methylcrotonyl-CoA carboxylase biotin-containing subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 148.4 bits, see alignment E=4.1e-47 PF02786: CPSase_L_D2" amino acids 116 to 327 (212 residues), 241.6 bits, see alignment E=2.5e-75 PF02222: ATP-grasp" amino acids 127 to 279 (153 residues), 32.1 bits, see alignment E=3.5e-11 PF07478: Dala_Dala_lig_C" amino acids 144 to 296 (153 residues), 35.5 bits, see alignment E=3.2e-12 PF02785: Biotin_carb_C" amino acids 341 to 446 (106 residues), 118.7 bits, see alignment E=5.3e-38 PF00364: Biotin_lipoyl" amino acids 584 to 649 (66 residues), 58.8 bits, see alignment E=1.5e-19 PF13533: Biotin_lipoyl_2" amino acids 586 to 620 (35 residues), 30.7 bits, see alignment (E = 8.6e-11)

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 100% identity to ccs:CCNA_02250)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9X8 at UniProt or InterPro

Protein Sequence (654 amino acids)

>CCNA_02250 methylcrotonyl-CoA carboxylase biotin-containing subunit (Caulobacter crescentus NA1000)
MLSSVLIANRGEIARRIIRTARELGVRTIAVYSEADANAPFVMEADAAILIGPAPAKESY
LDPRKILAAARQMGAEAIHPGYGFLSENAEFAQSVIDAGLVWIGPPPSAIRAMGLKDAAK
AVMIKAGVPTTPGYLGEDQSVERLTVEAAKIGYPVLIKAVAGGGGKGMRKVERAEDFEAA
LGSCRREASAAFGDDRVLLEKYVTRPRHIEVQVFGDSHGNVVHLFERDCSLQRRHQKVIE
EAPAPGMDEATREAVCAAAVKAAQAVNYVGAGTVEFIADASEGLRADRIWFMEMNTRLQV
EHPVTEMVTGQDLVEWQLRVASGEPLPLEQDEITLDGWAMEARLYAENPATGFLPSTGKL
KHFRLPEGDVRVDSAVEEGGEVTPFYDPMIAKLIAHGADREDAAQRLAEACALVEVWPVK
TNAAFLAKCASHPDFVDGAVDTGFIEARLDELTERAFSDEPAMAAIGWRLDSFLEAEARR
DPWEGAPSKLLGFRMNAPRASMHLPMSTDGKATPLRVALIGGGTEDWSWDIRHADGSTFD
EVTRLPTTYGKGPIQVFEGGDVQEFDFVAKIGGAGEGGASDGAILSPMPGKIVSVSVSAG
QTVSKGQTLLTLEAMKMEHAMAAPFDGVVAELSAVAGGQVSEGVVLARLEPAVA