Protein Info for CCNA_02225 in Caulobacter crescentus NA1000

Annotation: ArsR family/SAM-dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF12840: HTH_20" amino acids 17 to 62 (46 residues), 43.9 bits, see alignment 1e-14 PF01022: HTH_5" amino acids 18 to 62 (45 residues), 49.1 bits, see alignment 2.3e-16 PF12802: MarR_2" amino acids 21 to 63 (43 residues), 33.2 bits, see alignment 2.7e-11 PF13489: Methyltransf_23" amino acids 143 to 292 (150 residues), 45 bits, see alignment E=5.6e-15 PF00891: Methyltransf_2" amino acids 143 to 253 (111 residues), 22.3 bits, see alignment E=4.1e-08 PF01209: Ubie_methyltran" amino acids 144 to 262 (119 residues), 33.5 bits, see alignment E=1.6e-11 PF13847: Methyltransf_31" amino acids 155 to 270 (116 residues), 60.6 bits, see alignment E=8.8e-20 PF13649: Methyltransf_25" amino acids 157 to 249 (93 residues), 61.5 bits, see alignment E=5.8e-20 PF08241: Methyltransf_11" amino acids 157 to 253 (97 residues), 76.8 bits, see alignment E=9.1e-25 PF08242: Methyltransf_12" amino acids 157 to 251 (95 residues), 53.6 bits, see alignment E=1.7e-17

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to ccs:CCNA_02225)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9V6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CCNA_02225 ArsR family/SAM-dependent transcriptional regulator (Caulobacter crescentus NA1000)
MRLSAEQVVEVLRAAGESTRLRLLALLAAEELSVLELCRILDQSQPRVSRHLKLLAEAGL
VERFPDGAWVFYRLAAKSPGRLLVEQALDLIDEGDETVQSDADKLAAVRAERSTDAQAYF
ARNAARWNEIRSLYVDEAEVEAAILRATGEGPFDEMVDLGAGAGRMLTLLGKRAANALGL
DLSQQMLNIARDEVSKAGLTACELRHGDIFRTGLPGGCADLVTVHQVLHYLTDPATAVAE
AARLVTPGGLLLIADFAPHGHEFLREVHQHRRLGFDDAEIVAWLQAAGLVLESNIALPPA
TAEGLTVKIWTARRPGKASLERSAA