Protein Info for CCNA_02215 in Caulobacter crescentus NA1000

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02771: Acyl-CoA_dh_N" amino acids 7 to 121 (115 residues), 58.3 bits, see alignment E=1.5e-19 PF02770: Acyl-CoA_dh_M" amino acids 127 to 225 (99 residues), 74.5 bits, see alignment E=9e-25 PF00441: Acyl-CoA_dh_1" amino acids 237 to 400 (164 residues), 67.5 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2131)

Predicted SEED Role

"Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13)" (EC 1.3.99.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.13

Use Curated BLAST to search for 1.3.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9U5 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CCNA_02215 acyl-CoA dehydrogenase (Caulobacter crescentus NA1000)
MDLAFSAEDLAFQQEVRDWIATAYDDDLRRQMSQSKNGYLDKAGQVKWQKKLAERGWAAP
DWPVELGGAGFTPSQRYIFNMEMSLAGVPTSSPMGLKMVAPVIMAFGSDAQKAQHLPPIL
NSDIWWCQGYSEPGSGSDLASLQMRAVRDGDDYVLNGSKIWTTHAQWADWMFCLVRTSTE
GKPQEGISFLLLRMDTPGIQIKPLPTLDGPPDNEQEINQVFFDNVRVPVANRIGEENKGW
TYAKYLLEFERGNAYAPGLMNMLKKVKRIAALERADDGGRLIDDPDFRSKIANLEIQVEA
LNASELRIFSGRGAGKNIGPASSMLKCVGSEHQQAITELTLEAVGNYATPFVRDTWSPAN
DGRAGPDYAGPAAPAYFNYRKASIYAGSNEIQRNIMAKMVLGL