Protein Info for CCNA_02203 in Caulobacter crescentus NA1000

Annotation: YceI-like domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04264: YceI" amino acids 28 to 187 (160 residues), 140.2 bits, see alignment E=3.4e-45

Best Hits

Swiss-Prot: 36% identical to Y1570_ENT38: UPF0312 protein Ent638_1570 (Ent638_1570) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02203)

Predicted SEED Role

"YceI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C990 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CCNA_02203 YceI-like domain protein (Caulobacter crescentus NA1000)
MKRLLAAMIAGAALSVATAPAFAAEVAYKLDSSHTQTSFAIDRFGFTSILGMFAQSEGTI
WLDEAAPEKSRVEATVTVDSLLSANTARDEHLKAERWLNAAKNPTMTFKSTKVEKTGDTT
AKVTGDMTIMGVTQPVTLDVKLNKIGVGNNQKKQAGFTITGQISRKAFGHTIGAGAIGDA
VNIRIEALAVAQ