Protein Info for CCNA_02199 in Caulobacter crescentus NA1000

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF03602: Cons_hypoth95" amino acids 10 to 126 (117 residues), 24.9 bits, see alignment E=3e-09 PF05175: MTS" amino acids 31 to 125 (95 residues), 33.5 bits, see alignment E=6.5e-12 PF02384: N6_Mtase" amino acids 32 to 168 (137 residues), 32.4 bits, see alignment E=1.2e-11 PF13847: Methyltransf_31" amino acids 43 to 120 (78 residues), 31.2 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2114)

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9T1 at UniProt or InterPro

Protein Sequence (247 amino acids)

>CCNA_02199 methyltransferase (Caulobacter crescentus NA1000)
MNDLGVTEDRVLGGRVRLRQAPDGYRPGMDAALLAATCDALPGQRVLEPGCGVGGALLAA
ATRRPEAIFQGVERDETAASLAAENVALNGLTSRVAIAQGDVEAGFRALGLPVFDAVMAN
PPYFDDPSALRAPSPAKSGAWMADGGLAAWTAFCLKAVREGGTITLIHRADRLADILSLL
APKAGSFRIRPVAPFADAAAKRVIVRAIKTGKAPLVLLPPLVMHDRDGGKHSAQAEAILR
GEADLAW