Protein Info for CCNA_02186 in Caulobacter crescentus NA1000

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 26 to 181 (156 residues), 164.1 bits, E=1.2e-52
• PF01842: ACT
  • amino acids 30 to 91 (62 residues), 48 bits, E=1.2e-16
• PF13710: ACT_5
  • amino acids 33 to 96 (64 residues), 46.7 bits, E=3.3e-16
• PF10369: ALS_ss_C
  • amino acids 108 to 181 (74 residues), 86.3 bits, E=1.9e-28

Best Hits

Swiss-Prot: 46% identical to ILVH_ARCFU: Probable acetolactate synthase small subunit (ilvH) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to ccs:CCNA_02186)

MetaCyc: 48% identical to acetohydroxyacid synthase subunit H (Cupriavidus necator H16)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)
• superpathway of L-threonine metabolism (9/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A0A0H3CBE5 at UniProt or InterPro

Protein Sequence (185 amino acids)

>CCNA_02186 acetolactate synthase small subunit (Caulobacter crescentus NA1000)
MTANVQPAPASAYDLSPKDQAEQSATFALLVDNEPGVLHRVVGLFAARGYNIESLTVAET
DRKAHTSRITVVTRGTRHVLDQIEAQLNKVVNVRRVHDVTRDPNGVERELALVKVRGSGV
DRLEALRIAEIFRAKPVDTTLESFVFEISGAPSKIDKFLDLMRPLGLVELSRTGVLSIER
GFEGM