Protein Info for CCNA_02183 in Caulobacter crescentus NA1000

Annotation: tRNA delta(2)-isopentenylpyrophosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF01745: IPT" amino acids 10 to 60 (51 residues), 22.3 bits, see alignment 8.1e-09 TIGR00174: tRNA dimethylallyltransferase" amino acids 13 to 287 (275 residues), 225.5 bits, see alignment E=4.3e-71 PF01715: IPPT" amino acids 44 to 287 (244 residues), 250.4 bits, see alignment E=2.2e-78

Best Hits

Swiss-Prot: 100% identical to MIAA_CAUVN: tRNA dimethylallyltransferase (miaA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to ccr:CC_2098)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GXU1 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_02183 tRNA delta(2)-isopentenylpyrophosphate transferase (Caulobacter crescentus NA1000)
MVESSDIASRIWLIAGPTASGKSAYALDLAERIDGEIVNADSMQIYAGLRVLTAGPSQEE
TARAPHHLFQIVDPALGWSVGRWLEAATQALAEIQARGKPAIVVGGTGLYFRALTHGLAD
VPPVPETQREISSLLYAARGETEFREILKPLDPEAEARIESGDRQRLVRAHAVAITTGKS
LTAWQTDTKPALAPGSWKGLVLDPPRAELYARCDARLAVMVEQGALDEVRALETRGLDPA
LPALKAVGYREFAAHLRGETSLDQALDAARQETRRYAKRQLTWFRNQTPDWERIVP