Protein Info for CCNA_02180 in Caulobacter crescentus NA1000

Annotation: iron-sulfur cluster assembly/repair protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01883: FeS_assembly_P" amino acids 6 to 76 (71 residues), 53.4 bits, see alignment E=7.3e-18 PF10609: ParA" amino acids 115 to 357 (243 residues), 307.2 bits, see alignment E=2.5e-95 PF13614: AAA_31" amino acids 117 to 155 (39 residues), 35.6 bits, see alignment 2.7e-12 PF09140: MipZ" amino acids 117 to 164 (48 residues), 30.4 bits, see alignment 7.5e-11 PF01656: CbiA" amino acids 119 to 279 (161 residues), 50.9 bits, see alignment E=4.8e-17 PF02374: ArsA_ATPase" amino acids 121 to 153 (33 residues), 22.6 bits, see alignment 1.7e-08

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to ccs:CCNA_02180)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBE0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>CCNA_02180 iron-sulfur cluster assembly/repair protein ApbC (Caulobacter crescentus NA1000)
MTATLDDARAALDRIADPASGQGLVKAGLVQGLVVRNGRAGFMLEVPASVVASYAPVREA
AEKALAALPGVEQAQVVLTAQAAEGATRVRKGAKISEDPQARMVPPPEAEKPQHVRHVIA
VASGKGGVGKSTVSTNLAVAFAKMGLRVGLLDADIYGPSAPKMMGVDGDPLFENEKLQPL
EAHGVKLMSIGFIVDEGKAMIWRGPMASSAVRQMIHDVAWGSEAQPLDVLVVDLPPGTGD
VQLTLVQKLRIDGAVLVTTPQEIALIDARRAAAMFEKTATPILGLIENMAFFADPSTGAP
IPIFGEGGGVAEAARLNVPLLGRVPIEIAVRLGGDQGVPAVIGEPKGQAAEVFIGAAKVL
WKSVSH