Protein Info for CCNA_02174 in Caulobacter crescentus NA1000

Annotation: multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF16576: HlyD_D23" amino acids 63 to 261 (199 residues), 39.5 bits, see alignment E=6.1e-14 PF13533: Biotin_lipoyl_2" amino acids 64 to 111 (48 residues), 30.7 bits, see alignment 3.2e-11 PF13437: HlyD_3" amino acids 188 to 297 (110 residues), 32.4 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to ccr:CC_2092)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA08 at UniProt or InterPro

Protein Sequence (334 amino acids)

>CCNA_02174 multidrug resistance efflux pump (Caulobacter crescentus NA1000)
MPGFLRRPAFYIALVVVLLLGGGLFYAKGQQAEKKKKLEAAAAQEEPSPYAAIAQGKADV
EGGVIQVAARRQGIIREVFVQEGDIVKAGQPLAKQEDDDARLATQTASAALASAKAQLAL
HQVQLRTAQREFNRLQGLAASNYVAAQRLDAARDQIAQAQANIGTQQAQISVASAQLAQA
RFNEELTVIRAPADGRIARRQANPGSGASTLNVTAMFDLEPNTQRIARAEIVEADIPNVT
IGQEVEIQPEGDPDKTYVGKVLRRAAVFGARKLASDDPSQRSDERVVEVVVSADGAPLLV
GQRVLVKFMKPGQKAGVKRDKPTQPVAGGMTKKS