Protein Info for CCNA_02169 in Caulobacter crescentus NA1000

Annotation: thioesterase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details PF03061: 4HBT" amino acids 62 to 132 (71 residues), 57.4 bits, see alignment E=7.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2087)

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA05 at UniProt or InterPro

Protein Sequence (150 amino acids)

>CCNA_02169 thioesterase superfamily protein (Caulobacter crescentus NA1000)
MDGGAENSSSSRLVETGEWAGWRTWQGMDPFEDQSGPFYFREDETGRVTCAFRAEPKHMN
GGGFMHGGCMMTFADFCLFAIAWRDLAGSHAVTVSLNGEFVGPARPGDLITATGEVVRAG
GALLFVRGLISTGSSPMLNFSGVIKRIRSR