Protein Info for CCNA_02149 in Caulobacter crescentus NA1000

Annotation: 1-deoxy-D-xylulose 5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 8 to 281 (274 residues), 389.3 bits, E=2.8e-120
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 10 to 619 (610 residues), 786.5 bits, E=9.6e-241
• PF02779: Transket_pyr
  • amino acids 318 to 479 (162 residues), 150.3 bits, E=1.3e-47
• PF02780: Transketolase_C
  • amino acids 495 to 618 (124 residues), 102.5 bits, E=4.7e-33

Best Hits

Swiss-Prot: 100% identical to DXS_CAUVN: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to ccs:CCNA_02149)

MetaCyc: 56% identical to 1-deoxy-D-xylulose 5-phosphate synthase (Arabidopsis thaliana col)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (10/12 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• isoprene biosynthesis I (8/10 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See B8GXC4 at UniProt or InterPro

Protein Sequence (640 amino acids)

>CCNA_02149 1-deoxy-D-xylulose 5-phosphate synthase (Caulobacter crescentus NA1000)
MSSKTPLLDTIASPADTRGLSLAELKQLAAEVRAETIDAVSVTGGHLGAGLGVVELTVAL
HHVFETPKDIVIWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRAESEYDPFGAAHA
ATSISAALGFCAARDAKGEDNSVIAVIGDGSLGAGMAYEAMNAATDTTKRLIVILNDNDM
SIAPPVGGMSAYLANLVSGGAYRSVRKLGKTVVEKLPTPMREAARKAEEYARGMVTGGTF
FEELGFYYIGPIDGHDMDALVSVLKNAKAFGDKPVLVHCVTQKGKGYAPAEGAADKLHAV
VKFDVVTGQQQKAAGGPPSYTKVFAQELIKQAEKDDKIVAITAAMPSGTGLDLFGKAFPE
RTFDVGIAEQHAVTFAAGMAADGMKPFAAIYSTFLQRGYDQVVHDVAIQGLPVRFAMDRA
GLVGADGPTHAGSFDIGFMGALPGMVLMAAADEVELARMVATAAEIDDRPSAFRYPRGEG
LGLDMPAIAEPLEIGKGRIVREGTSVAIVSFGTRLSESLKAADLLAARGLSATVCDARFA
KPLDLDLLLRLAREHEAIITVEEGSMGGFGAFVLQALAQHGALDRGLKIRTLCLPDVFQD
QDKPDAMYAQAGLDAEGILRGALSAMGMDNVSAAGAGRRA