Protein Info for CCNA_02144 in Caulobacter crescentus NA1000

Annotation: flagella basal body P ring formation protein flgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 119 to 248 (130 residues), 112.7 bits, see alignment E=6.6e-37 PF08666: SAF" amino acids 128 to 186 (59 residues), 40.5 bits, see alignment E=3.3e-14 PF13144: ChapFlgA" amino acids 128 to 247 (120 residues), 85.6 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 100% identical to FLAD_CAUVC: Distal basal body ring component protein (flaD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to ccs:CCNA_02144)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9P2 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CCNA_02144 flagella basal body P ring formation protein flgA (Caulobacter crescentus NA1000)
MKAFLFAAAATLVITALSAPAFAGTPVTLRMDTTDADGRITLGDLFDGVSGPAANVVVAA
RMSATAVLEAGQVQMSARRAGYVWTNANGVRRIIVREGVDNGGVSSSAAPGAQLAGARLA
GAPRANVEVLAYARSLSAGEIVQPQDLIWVKMAGAPADAPRDADAVIGLAAKRPLREGAP
VGMKDVAAAQVIKSGDLITITYEDGGISLSLQGKAMAAAAAGDVFAVQNTLSKKIIQAVA
VGPGAAAVGPQAQSLQARSQPLRFAAR