Protein Info for CCNA_02141 in Caulobacter crescentus NA1000

Annotation: flagellar fliL protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details PF03748: FliL" amino acids 108 to 204 (97 residues), 65.8 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 100% identical to FLIL_CAUVC: Flagellar FliL protein (fliL) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02415, flagellar FliL protein (inferred from 100% identity to ccs:CCNA_02141)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GXB6 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CCNA_02141 flagellar fliL protein (Caulobacter crescentus NA1000)
MAKKPEKEAPAPEGEEGAEGEAPAKKKPPILIIAIAAGVLVLGGGGAAAFFLLKPKPAAE
AGEHGEKKEEKKKEKKKEEKGDKKDAEKGAEGAAGTPVIKEGPDGVVFYTLPDIVVNMQT
ADGKSTFLKLKLTFELPDEETADELTPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVE
LLRRVNLVAAPAKVNAVLIEEMLIN