Protein Info for CCNA_02140 in Caulobacter crescentus NA1000

Annotation: flagellar motor switch protein fliM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR01397: flagellar motor switch protein FliM" amino acids 50 to 362 (313 residues), 359 bits, see alignment E=1.1e-111 PF02154: FliM" amino acids 78 to 270 (193 residues), 247.5 bits, see alignment E=9.9e-78 PF01052: FliMN_C" amino acids 292 to 357 (66 residues), 62.6 bits, see alignment E=2.7e-21

Best Hits

Swiss-Prot: 100% identical to FLIM_CAUVN: Flagellar motor switch protein FliM (fliM) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 100% identity to ccs:CCNA_02140)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GXB5 at UniProt or InterPro

Protein Sequence (374 amino acids)

>CCNA_02140 flagellar motor switch protein fliM (Caulobacter crescentus NA1000)
MADELDDQAAMAQWASENPPGGGEGVNEFGDFSGGMGGWDDGGGDGASERILNQDEIDSL
LGFDLSGDGSDDRTGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSL
DNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAMR
IEGRPYTTIERVLVQRMIEVVLHDLKSAFEPLHPVSFSLDRLETNPRFAAIARPANAAIL
VKLRIDMEDRGGRIELLLPYATLEPIRKMLLQQFMGEKFGRDNIWEGHLATELWTTQMEV
RAVLDEQQVPLSRVLNMQVGDTLMLNATPDSLVELRAGAIPLTRGRMGRRNHSIAVRAEA
PLTPAAKKAVQKLK