Protein Info for CCNA_02081 in Caulobacter crescentus NA1000

Annotation: Sec-independent protein translocase protein tatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details TIGR01410: twin arginine-targeting protein translocase TatB" amino acids 4 to 81 (78 residues), 96.9 bits, see alignment E=4.1e-32 PF02416: TatA_B_E" amino acids 5 to 35 (31 residues), 26.1 bits, see alignment 2e-10

Best Hits

Swiss-Prot: 100% identical to TATB_CAUVC: Sec-independent protein translocase protein TatB (tatB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 100% identity to ccr:CC_2002)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX56 at UniProt or InterPro

Protein Sequence (200 amino acids)

>CCNA_02081 Sec-independent protein translocase protein tatB (Caulobacter crescentus NA1000)
MLPDIGGTELLIIAAVALIVVGPKDLPALLRKVGQFVGRMRGMASEFRASFDEMARQSEL
DELRREVQAMRSGQFTNPVQDAADAARDVQVDQVFADIDASLSSGAMQAHPYAAGETHNS
ILPTAEPSAEIVEAKPKRAPRKKAVAEPVAAEPVLVEPVKAPRKRASQKQEITVEAPKAV
RAPRKRASKAGDSTASDIVS