Protein Info for CCNA_02073 in Caulobacter crescentus NA1000

Annotation: cupin domain transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF13560: HTH_31" amino acids 13 to 68 (56 residues), 56 bits, see alignment E=1e-18 PF12844: HTH_19" amino acids 16 to 75 (60 residues), 33.5 bits, see alignment E=8.7e-12 PF13443: HTH_26" amino acids 17 to 74 (58 residues), 27.5 bits, see alignment E=7.6e-10 PF01381: HTH_3" amino acids 19 to 70 (52 residues), 49.7 bits, see alignment E=7.9e-17 PF07883: Cupin_2" amino acids 143 to 194 (52 residues), 27.5 bits, see alignment E=5.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1994)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8W9 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CCNA_02073 cupin domain transcriptional regulator (Caulobacter crescentus NA1000)
MPPTDADTAADLALAARLETLRRERDLSLDAAAALTGLSRATISRIERGETSPTANALGR
LCNAYGLTMSRLLAAVETSAPRLLRGVDAARWRDPESGFLRTLIAPPTEGYATELALGEL
PPGAEVRYELDRPQREGYAPAGREQFFYLIAGELHLDIEAETYRLSPGDCLRHHGVDAKR
IANPGAELARYLIINTTTV