Protein Info for CCNA_02066 in Caulobacter crescentus NA1000
Annotation: phytoene/squalene synthase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02291, phytoene synthase [EC: 2.5.1.32] (inferred from 100% identity to ccs:CCNA_02066)Predicted SEED Role
"Pro-zeta-carotene desaturase, prolycopene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)
MetaCyc Pathways
- neurosporene biosynthesis (2/5 steps found)
- trans-lycopene biosynthesis I (2/6 steps found)
- trans-lycopene biosynthesis II (oxygenic phototrophs and green sulfur bacteria) (3/8 steps found)
- β-carotene biosynthesis (engineered) (2/8 steps found)
- lycopadiene biosynthesis (1/7 steps found)
- superpathway of carotenoid biosynthesis in plants (3/22 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 2.5.1.32
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CB12 at UniProt or InterPro
Protein Sequence (237 amino acids)
>CCNA_02066 phytoene/squalene synthase family protein (Caulobacter crescentus NA1000) MADTETLDDLVRRVDPDRWLATRFIADPAARADVIALYGLNYELARVAGGVSNALMGEIR LTWWREAMEEIAAGKPPRKHPNVEALASSGFDPNALAVLAEARFVDLDEAPLKDEAAVLA YIDGTAGALAVLAARRLDPAADPHAVKGAARAWGLSGLWRLKSAGRSRLPEDWTQADVKQ RVEAQLKAARSEVRGLPVAAFPAVAPAALARAYVSGREMGELEKKLRLTLAVATGRL