Protein Info for CCNA_02063 in Caulobacter crescentus NA1000

Annotation: beta-barrel assembly machine (BAM) protein BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 15 to 251 (237 residues), 282.2 bits, see alignment E=1.7e-88 PF13512: TPR_18" amino acids 44 to 168 (125 residues), 66.4 bits, see alignment E=1.1e-21 PF13525: YfiO" amino acids 44 to 236 (193 residues), 182.8 bits, see alignment E=2.5e-57 PF13432: TPR_16" amino acids 54 to 116 (63 residues), 25.4 bits, see alignment E=5.8e-09 amino acids 86 to 159 (74 residues), 22 bits, see alignment E=6.7e-08 amino acids 184 to 234 (51 residues), 20.2 bits, see alignment 2.5e-07 PF13174: TPR_6" amino acids 85 to 114 (30 residues), 16.9 bits, see alignment (E = 2.7e-06) amino acids 120 to 160 (41 residues), 20.6 bits, see alignment 1.9e-07

Best Hits

Swiss-Prot: 100% identical to BAMD_CAUVC: Outer membrane protein assembly factor BamD (bamD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to ccs:CCNA_02063)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8V9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>CCNA_02063 beta-barrel assembly machine (BAM) protein BamD (Caulobacter crescentus NA1000)
MRESVLRIFQGRPAVTIAAVLVAASVAGCAGKAKKPTLVYEERPVELLYSTGADRLDRGN
WNEAVDYFREVERQHPYSEWSRRSILMTGYAHYMGNQYAEAIGDADRFISLYPGNPSAQY
AFYLKAICYFEQIVDVNRDQAATEQALAALRDVVQRYPNTEYATDARLKIDMVNDQLAGK
EMAIGRWYLKNGQTLAAIGRFKAVIERHQTTSHTPEALFRLVEAYLTIGLNEEAKRNGAV
LGYNFPGDRWYVDAYRLLNDNGLRPAVEPLKAGAKRNALERILSKDKEATLAPPGERKAK
KGLLGPLGM