Protein Info for CCNA_02043 in Caulobacter crescentus NA1000

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR00197: YjeF family N-terminal domain" amino acids 5 to 201 (197 residues), 130.1 bits, see alignment E=8.5e-42 PF03853: YjeF_N" amino acids 27 to 179 (153 residues), 127.6 bits, see alignment E=4.9e-41 TIGR00196: YjeF family C-terminal domain" amino acids 226 to 458 (233 residues), 161.2 bits, see alignment E=3.3e-51 PF01256: Carb_kinase" amino acids 236 to 458 (223 residues), 165.7 bits, see alignment E=1.3e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02043)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9N6 at UniProt or InterPro

Protein Sequence (483 amino acids)

>CCNA_02043 sugar kinase (Caulobacter crescentus NA1000)
MAREILTVAEMAASDRAAVLAGTPIPVLMERAGEAVAQAVRARYQRRPVVVWCGPGDNGG
DGYVAARHLRRHGWPVVVEAAYPPATDACRWAASRWRGEVKPLSQRLAAEALYIDAMFGA
GLSRPLEGEVAELARTAVRQALTIVAVDTPSGVHGDTGRSLDGVALAAELTITFHRRKPA
HVLIEGRKACGDILVSDIGLSTVASAALFENDPSLWRERYPWPAIDAHKHSRGRLSVVSG
DAWNTGAARLAARGGLRIGAGAVTLLSPPSALSVNASHLEAVMLASFESDADLAARAEKA
DAVIIGPAAGVGDATARNLRALTQTGAALVADADALTSFRDDPGELFACLDRDDVLTPHP
GEFERIFPGLLGRSPERITAAREAASAAGAVILLKGADTVIAAPDGRAAVGLNGTPWLAT
AGSGDVLAGFIGGLLAQGMGSFEAACAGAWIHAECGALHGPGLIAEDLPGLAPAILARLH
QER