Protein Info for CCNA_02040 in Caulobacter crescentus NA1000

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 53 to 70 (18 residues), see Phobius details TIGR01490: HAD hydrolase, family IB" amino acids 27 to 218 (192 residues), 196.6 bits, see alignment E=5.7e-62 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 27 to 208 (182 residues), 127.5 bits, see alignment E=5.6e-41 PF00702: Hydrolase" amino acids 27 to 209 (183 residues), 49.2 bits, see alignment E=8.9e-17 PF12710: HAD" amino acids 28 to 206 (179 residues), 113.7 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 100% identical to CICA_CAUVC: Protein CicA (cicA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02040)

Predicted SEED Role

"cicA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX15 at UniProt or InterPro

Protein Sequence (222 amino acids)

>CCNA_02040 phosphoserine phosphatase (Caulobacter crescentus NA1000)
MAKRSWMAKGLSASRPMTGEMGHEPLLVAFDFDGTLTVKDSFNAFLKWRAGPRWSFGVLR
LTPALIAYVFDRNRGKLKAAAVRQFLKGATVAQIENDARAFAEAFAPSLLRPDAVAVWRG
WRAKGAKMVIVTASPDLIVAPFARGLGADLLIGTRLRCSDDGRILGGLDGNNCRAKEKVI
RLREVFGPDVRLTAAYGDTSGDTEMLAIADEKGYRIFRGKPA