Protein Info for CCNA_02016 in Caulobacter crescentus NA1000

Annotation: NADH-quinone oxidoreductase chain M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 459 to 478 (20 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 11 to 491 (481 residues), 645.5 bits, see alignment E=2.6e-198 PF01059: Oxidored_q5_N" amino acids 44 to 131 (88 residues), 26.2 bits, see alignment E=7.3e-10 PF00361: Proton_antipo_M" amino acids 139 to 421 (283 residues), 300.7 bits, see alignment E=1.1e-93

Best Hits

Swiss-Prot: 65% identical to NUOM_RHOCA: NADH-quinone oxidoreductase subunit M (nuoM) from Rhodobacter capsulatus

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 100% identity to ccs:CCNA_02016)

MetaCyc: 42% identical to ferredoxin-plastoquinone oxidoreductase subunit D2 (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7Z6 at UniProt or InterPro

Protein Sequence (500 amino acids)

>CCNA_02016 NADH-quinone oxidoreductase chain M (Caulobacter crescentus NA1000)
MRGTELMSGLLSLTTFAPLAGVAVILAARALHGAGEKTDTLAKWIALVTTLVTFGLSIVL
TVQFDPKNPGFQFVEDIAWFAGLHYRMGVDGISVLFVLLTAFLLPICIVASWKSVEKRVV
EYLIAFLVLETLVIGVFCALDIVLFYLFFEGGLVPMFLIIGIWGGKRRIYAAYKFFLYTL
LGSVLMLAAILAMIGISGTSSIPELMTFKFAPWLQTWLWLAFFASFAVKMPMWPVHTWLP
DAHVEAPTAGSVILAGILLKMGGYGFMRFSLPMFPNASEMFQPLVFALSAIAIVYTSLVA
FRQTDIKKLIAYSSVAHMGFVTMGIFSGNAAGEQGALFQMLSHGIISGALFLCVGVVYDR
MHTREIAFYGGLTNRMPMYAAVFMLFTMGNVGLPGTSGFVGEILTMTGVYKASTWTAIVS
ALGVILSAMYALTLYRRVMFGEITNPQLATITDLDKREILIFAPLIVSTLVLGIYPNLVF
NLTATSVDALVGAWRAAVGG