Protein Info for CCNA_02015 in Caulobacter crescentus NA1000

Annotation: NADH-quinone oxidoreductase chain N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 14 to 468 (455 residues), 431.6 bits, see alignment E=2.2e-133 PF00361: Proton_antipo_M" amino acids 125 to 415 (291 residues), 255.4 bits, see alignment E=3.5e-80

Best Hits

Swiss-Prot: 84% identical to NUON_CAUSK: NADH-quinone oxidoreductase subunit N (nuoN) from Caulobacter sp. (strain K31)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 100% identity to ccs:CCNA_02015)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAW8 at UniProt or InterPro

Protein Sequence (486 amino acids)

>CCNA_02015 NADH-quinone oxidoreductase chain N (Caulobacter crescentus NA1000)
MGEEPMTFSANFSLVLPEVVLAIAALVLLVAGTFRGKVGAIFTLAAVASLIAAAATAVLG
PKGVAFGGVYVADAAATYAKVAIYLSSAVAVVLGDRWLAQRGDQKFEYAVLVILAALGMG
VTASAGDLISLYIGVELQSLALYVLAAMRRDDAKSSEAGLKYFVLGALSSGLLLYGSSLI
YGFTGSTHFSQIALAAAHGGSHGVGLLFGLVFVICGLAFKVSAAPFHMWTPDVYEGAPTP
VVGFFSAAPKLAAMMMFARVLGDAFPASEEQWRQILVIAALLSVFVGAFAGLAQSNLKRL
WAYSSIANVGYALLGVAAGGEVGLQSMLIFMTLYMVDVTGFFACLQALNRDGKPMETIQD
MAGLVKQRPGIALAMTAFSLSALGLPPFSGFWAKYFVFKAAMGSGDVMLQWAAVIGLVGS
VVAAFYYLRLIKAMWFDDAAGAVDAPSPSARAVGFAAAIFSFPIVLVALVWLEPAAKAAA
AAFGHA