Protein Info for CCNA_02014 in Caulobacter crescentus NA1000

Annotation: Biotin-(acetyl-CoA carboxylase) ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 77 to 96 (20 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 12 to 245 (234 residues), 130 bits, see alignment E=5.4e-42 PF03099: BPL_LplA_LipB" amino acids 35 to 125 (91 residues), 57.4 bits, see alignment E=2.3e-19 PF16917: BPL_LplA_LipB_2" amino acids 54 to 196 (143 residues), 33.5 bits, see alignment E=4.6e-12 PF02237: BPL_C" amino acids 202 to 248 (47 residues), 52.7 bits, see alignment 5e-18

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to ccr:CC_1936)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9M0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>CCNA_02014 Biotin-(acetyl-CoA carboxylase) ligase (Caulobacter crescentus NA1000)
MTGVSPVTVPPIVVLDEIDSTNAEARRRAEAGAVEPLWLVGLRQTAGRGRRGRAWETGEG
NLAATLLFRTERPPAEAAQVSFVAALAVADLLARYVPSHLISLKWPNDPLLGGLKVSGIL
VESGASPFGGLWLAVGIGVNLKRKPIDAERPATAIATYLEAPPSPQEAAEVLAEAFERWL
RTWDILGFRAIADAWTARAHGLGEPCVARLGHETVEGVAEALDADGALRLRLADGSLRRI
TAGDVFFGGA