Protein Info for CCNA_02012 in Caulobacter crescentus NA1000

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF00753: Lactamase_B" amino acids 33 to 168 (136 residues), 35.5 bits, see alignment E=2.6e-12 PF12706: Lactamase_B_2" amino acids 67 to 173 (107 residues), 40.5 bits, see alignment E=5.8e-14 PF22505: RNase_J_b_CASP" amino acids 229 to 352 (124 residues), 134.8 bits, see alignment E=3.6e-43 PF07521: RMMBL" amino acids 369 to 412 (44 residues), 35.9 bits, see alignment 1.5e-12 PF17770: RNase_J_C" amino acids 458 to 559 (102 residues), 42.7 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 46% identical to RNJ_SINM2: Ribonuclease J (rnj) from Sinorhizobium meliloti (strain Sm2011 / Rm2011 / 2011)

KEGG orthology group: K07021, (no description) (inferred from 100% identity to ccs:CCNA_02012)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8R5 at UniProt or InterPro

Protein Sequence (559 amino acids)

>CCNA_02012 metal-dependent hydrolase (Caulobacter crescentus NA1000)
MKKSKNDEFVFLPLGGSNEIGMNFNLYGFGPAHDRKWIVVDLGVTFGDQTTPGVEIILPD
PSYIEPYADDILGIVLTHAHEDHLGAVHWLWPRLKAPVFATPFTAFLLREKLRDADLLGE
VEITEVPLGGSFKLGPFELELITLTHSIPEPNGLAIKTPLGTVLHTGDWKIDPDPQLGAP
TDEAAIRRLGDEGVLAMVCDSTNVFQEGSAGSEADVRTALGDLIKSLNGKIAVACFASNV
ARMDTVIRAAQACGRKVSLAGRSMHRMAAAARSVGLLEGLEPFINDDQAKHLPENEVLYL
CTGSQGEARAALSRIADGSHPHVKMGSGDHVIFSSRVIPGNEIPIRNLQNKLADRGVRLH
TERDTPGIHVSGHPCRDELRQMYAWVRPHIAVPTHGERRHLIEHAALAKDLQVPHAVSPR
NGDMVLLAPGQPGIIDEVPAGRLYVDGGVVTPENGEALRERRHAAFNGVLAVSIVLDGRN
KIVSGPQIRGIGLTGDDEYTLDDALDDLCEEAESAYKKLDGDAREIDETIESAISRAVKK
AAFRIWERKPVVETTVLRI