Protein Info for CCNA_02007 in Caulobacter crescentus NA1000

Annotation: lipoprotein releasing system transmembrane protein lolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 327 to 358 (32 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 13 to 426 (414 residues), 514.7 bits, see alignment E=9.2e-159 PF12704: MacB_PCD" amino acids 35 to 254 (220 residues), 68.4 bits, see alignment E=1.1e-22 PF02687: FtsX" amino acids 286 to 419 (134 residues), 57.1 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to ccs:CCNA_02007)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9A2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>CCNA_02007 lipoprotein releasing system transmembrane protein lolE (Caulobacter crescentus NA1000)
MPDARAAGPFSRWERSVARRYLFAKRKNGGVALISVISFSAVMLAVFALITVMSVMNGFR
AELLGRILGFNGHLYAQSPLINGPDRDTIIRRIKAAPGVIQAAPMVEAQAMVIGPTQVTG
AIVRGVTTSDLRHMSLISGNIKNGSMEGFGQGEYGGDIVLIGERMAQTLGVQPGDPITII
SPSGPATAFGSSTREKNYIVGGVFSVGMSQFDEAFIYMPLEQAQLFFGRDTTVDYVEIKV
EDPDKAKELKQAVEIASGPGALVNDWMDKNHSYFTALQVERKVMRLILFCIVAIATLNII
SSLVMLVKNKGKDIAILRTMGASQGAVLRIFLMAGASIGVAGTLCGLALGVLFCAYITPI
QNFVEWATGTSVFNADVYMLSHIPAKIDWREVGGIVLASAAMSILATLPPALRASRLDPV
EALRYE