Protein Info for CCNA_02005 in Caulobacter crescentus NA1000

Annotation: inosine-uridine nucleoside N-ribohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 3 to 311 (309 residues), 266 bits, E=2.8e-83

Best Hits

KEGG orthology group: K01239, purine nucleosidase [EC: 3.2.2.1] (inferred from 100% identity to ccs:CCNA_02005)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• adenine and adenosine salvage II (1/2 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.1

Use Curated BLAST to search for 3.2.2.1

Sequence Analysis Tools

See A0A0H3C7Y5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>CCNA_02005 inosine-uridine nucleoside N-ribohydrolase (Caulobacter crescentus NA1000)
MRLIIDTDTAGDDVFSLMLALTRTGVELEAITIAHGNVGFEQHAENALVTLDRCGRAGEV
PVYLGAQFPLMRAPLDAAYVFGRDGMSDSGFARTSQRPAEGHAVDELVRRIMAAPGEITL
IAQAPLTNIALAYQREPRIAKALKHLWVMGGTDNGVGNVTPAAEYNFYADPEAAKIVVNA
GFNLSIATWTLTLKDGLWTTEKLDALDALGTEKARFFTDVNRASLAFARETEGLDGSLHP
DALTCAIALDEGLILEAETCVVDVETVGELTRGYLSVSHSILPDIEIADPALKRRPPNAR
VIKAIDREGFFAAMRTALL