Protein Info for CCNA_01996 in Caulobacter crescentus NA1000

Annotation: undecaprenyl pyrophosphate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 24 to 248 (225 residues), 271.3 bits, see alignment E=3e-85 PF01255: Prenyltransf" amino acids 28 to 248 (221 residues), 270.2 bits, see alignment E=6.5e-85

Best Hits

Swiss-Prot: 100% identical to ISPT_CAUVC: Isoprenyl transferase (uppS) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to ccs:CCNA_01996)

MetaCyc: 44% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8Q5 at UniProt or InterPro

Protein Sequence (259 amino acids)

>CCNA_01996 undecaprenyl pyrophosphate synthetase (Caulobacter crescentus NA1000)
MPATTGPQDVSGRAGGPASTERLHVAIIMDGNGRWAKQRGMPRVLGHRAGVNALKRTVEG
AQSQNVGVLTVFGFSTENWSRPPQEVSELMGLLKAYVESDLERLAKAGVRVRIIGRRTGL
SPDIAEVIERAERRTAQNSEFVLQVAFNYGGQADITDAARAFAERVERGEAKASDLNEKT
FEQFLSTASAPPPDLIVRTSGERRISNFLLWDCAYAELVFQDVLWPDYGPEALAAAIAEY
RGRDRRYGGVAADDVAVAG